Overview

  • Product name
    Recombinant Human DEF6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALRKELLKSIWYAFTALDVEKSGKVSKSQLKVLSHNLYTVLHIPHDPVA LEEHFRDDDDGPVSSQGYMPYLNKYILDKVEEGAFVKEHFDELCWTLTAK KNYRADSNGNSMLSNQDAFRLWCLFNFLSEDKYPLIMVPDEVEYLLKKVL SSMSLEVSLGELEELLAQEAQVAQTTGGLSVWQFLELFNSGRCLRGVGRD TLSMAIHEVYQELIQDVLKQGYLWKRGHLRRNWAERWFQLQPSCLCYFGS EECKEKRGIIPLDAHCCVEVLPDRDGKRCMFCVKTATRTYEMSASDTRQR QEWTAAIQMAIRLQAEGKTSLHKDLKQKRREQREQR
    • Amino acids
      1 to 336
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DEF-6
    • Def6
    • DEFI6_HUMAN
    • Differentially expressed in FDCP 6 homolog
    • Differentially expressed in FDCP 6 homologue mouse
    • IBP
    • IRF4-binding protein
    • Swap70 like adapter of T cells
    see all
  • Function
    Phosphatidylinositol 3,4,5-trisphosphate-dependent guanine nucleotide exchange factor (GEF) which plays a role in the activation of Rho GTPases RAC1, RhoA and CDC42. Can regulate cell morphology in cooperation with activated RAC1. Plays a role in Th2 (T helper cells) development and/or activation, perhaps by interfering with ZAP-70 signaling.
  • Tissue specificity
    Broadly expressed in the immune system and can be detected in T and B-cells.
  • Sequence similarities
    Contains 1 PH domain.
  • Domain
    The PH domain is essential for phosphatidylinositol 3,4,5-trisphosphate binding.
  • Post-translational
    modifications
    Tyrosine-phosphorylated by tyrosine-protein kinase LCK in response to T-cell activation.
  • Cellular localization
    Cytoplasm. Cell membrane. Nucleus. Recruited to the plasma membrane upon binding phosphatidylinositol 3,4,5-trisphosphate.
  • Information by UniProt

Images

  • ab153323 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up