Overview

  • Product name
    Recombinant Human DEFA6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFA VSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha 6
    • DEF6
    • DEF6_HUMAN
    • DEFA 6
    • DEFA6
    • Defensin
    • Defensin 6
    • Defensin alpha 6
    • Defensin alpha 6 Paneth cell specific
    • Defensin-6
    • HD 6
    • HD6
    see all
  • Function
    Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1.
  • Tissue specificity
    Paneth cells of the small intestine.
  • Sequence similarities
    Belongs to the alpha-defensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Recombinant Human DEFA6 protein images

  • 12.5% SDS-PAGE showing ab116983 at approximately 37.07kDa.
    Stained with Coomassie Blue.

References for Recombinant Human DEFA6 protein (ab116983)

ab116983 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up