Overview

  • Product name
    Recombinant Human DEFA6 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MRTLTILTAVLLVALQAKAEPLQAEDDPLQAKAYEADAQEQRGANDQDFA VSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFCCL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Associated products

Specifications

Our Abpromise guarantee covers the use of ab116983 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • alpha 6
    • DEF6
    • DEF6_HUMAN
    • DEFA 6
    • DEFA6
    • Defensin
    • Defensin 6
    • Defensin alpha 6
    • Defensin alpha 6 Paneth cell specific
    • Defensin-6
    • HD 6
    • HD6
    see all
  • Function
    Has very low antimicrobial activity against Gram-negative and Gram-positive bacteria. May protect cells against infection with HIV-1.
  • Tissue specificity
    Paneth cells of the small intestine.
  • Sequence similarities
    Belongs to the alpha-defensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab116983 at approximately 37.07kDa.
    Stained with Coomassie Blue.

References

ab116983 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab116983.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up