Recombinant Human DEFB118 protein (ab174392)

Overview

  • Product name
    Recombinant Human DEFB118 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSYSGEKKCWNRSGHCRKQCKDGEAVKDT CKNLRACCIPSNEDHRRVPATSPTPLSDSTPGIIDDILTVRFTTDYFEVS SKKDMVEESEAGRGTETSLPNVHHSS
    • Molecular weight
      14 kDa including tags
    • Amino acids
      21 to 123
    • Tags
      His tag N-Terminus
    • Additional sequence information
      (NCBI Accession No.: NP_473453).

Specifications

Our Abpromise guarantee covers the use of ab174392 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity
    >90% by SDS-PAGE.
    ab174392 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

General Info

  • Alternative names
    • beta 118
    • Beta-defensin 118
    • Beta-defensin 118 precursor
    • Beta-defensin 18
    • C20orf63
    • Chromosome 20 open reading frame 63
    • DB118_HUMAN
    • DEFB-18
    • DEFB118
    • Defensin
    • Defensin beta 18
    • Defensin, beta 118
    • Epididymal secretory protein 13.6
    • epididymus specific clone 42
    • ESC42
    • ESP13.6
    see all
  • Function
    Has antibacterial activity.
  • Tissue specificity
    High-level and epididymis-specific expression. Most abundant in the epithelium of the caput and is also present in the lumen and bound to sperm. Expressed also in pancreas.
  • Sequence similarities
    Belongs to the beta-defensin family.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab174392.

References

ab174392 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab174392.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up