Overview

  • Product name
    Recombinant Human DEGS2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGNSASRSDFEWVYTDQPHTQRRKEILAKYPAIKALMRPDPRLKWAVLVL VLVQMLTCWLVRGLAWRWLLFWAYAFGGCVNHSLTLAIHDISHNAAFGTG RAARNRWLAVFANLPVGVPYAASFKKYHVDHHRYLGGDGLDVDVPTRLEG WFFCTPARKLLWLVLQPFFYSLRPLCVHPKAVTRMEVLNTLVQLAADLAI FALWGLKPVVYLLASSFLGLGLHPISGHFVAEHYMFLKGHETYSYYGPLN WITFNVGYHVEHHDFPSIPGYNLPLVRKIAPEYYDHLPQHHSWVKVLWDF VFEDSLGPYARVKRVYRLAKDGL
    • Amino acids
      1 to 323
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165196 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C14orf66
    • Degenerative spermatocyte homolog 2
    • Degenerative spermatocyte homolog 2, lipid desaturase
    • Degs2
    • DEGS2_HUMAN
    • DES2
    • FADS8
    • Sphingolipid C4-hydroxylase/delta 4-desaturase
    • Sphingolipid delta(4)-desaturase/C4-hydroxylase DES2
    see all
  • Function
    Bifunctional enzyme which acts as both a sphingolipid delta(4)-desaturase and a sphingolipid C4-hydroxylase.
  • Tissue specificity
    Highly expressed in skin, intestine and kidney.
  • Pathway
    Membrane lipid metabolism; sphingolipid biosynthesis.
  • Sequence similarities
    Belongs to the fatty acid desaturase family. DEGS subfamily.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab165196 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165196 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165196.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up