Recombinant Human delta 1 Catenin protein (ab114472)

Overview

  • Product name
    Recombinant Human delta 1 Catenin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      WGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKS DKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPL KGTTPLMQKI
    • Molecular weight
      38 kDa including tags
    • Amino acids
      721 to 830

Specifications

Our Abpromise guarantee covers the use of ab114472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114472 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cadherin associated Src substrate
    • Cadherin-associated Src substrate
    • CAS
    • Catenin (cadherin associated protein) delta 1
    • Catenin delta
    • Catenin delta 1
    • Catenin delta-1
    • CTND1_HUMAN
    • CTNND
    • CTNND 1
    • CTNND1
    • KIAA0384
    • p120
    • P120 CAS
    • p120 catenin
    • P120 CTN
    • p120(cas)
    • p120(ctn)
    • P120CAS
    • P120CTN
    see all
  • Function
    Binds to and inhibits the transcriptional repressor ZBTB33, which may lead to activation of target genes of the Wnt signaling pathway (By similarity). May associate with and regulate the cell adhesion properties of both C- and E-cadherins. Implicated both in cell transformation by SRC and in ligand-induced receptor signaling through the EGF, PDGF, CSF-1 and ERBB2 receptors. Promotes GLIS2 C-terminal cleavage.
  • Tissue specificity
    Expressed in vascular endothelium.
  • Sequence similarities
    Belongs to the beta-catenin family.
    Contains 10 ARM repeats.
  • Domain
    A possible nuclear localization signal exists in all isoforms where Asp-626--631-Arg are deleted.
  • Post-translational
    modifications
    Phosphorylated by protein-tyrosine kinases. Dephosphorylated by PTPRJ.
  • Cellular localization
    Cytoplasm. Nucleus. Cell membrane. Interaction with GLIS2 promotes nuclear translocation (By similarity). NANOS1 induces its translocation from sites of cell-cell contact to the cytoplasm.
  • Information by UniProt

Images

  • ab114472 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114472 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up