Recombinant Human delta 1 Catenin protein (ab114472)

Overview

  • Product nameRecombinant Human delta 1 Catenin protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ96FS1
    • SpeciesHuman
    • SequenceWGYKELRKPLEKEGWKKSDFQVNLNNASRSQSSHSYDDSTLPLIDRNQKS DKKPDREEIQMSNMGSNTKSLDNNYSTPNERGDHNKTLDRSGDLGDMEPL KGTTPLMQKI
    • Molecular weight38 kDa including tags
    • Amino acids721 to 830

Specifications

Our Abpromise guarantee covers the use of ab114472 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    ab114472 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • Cadherin associated Src substrate
    • Cadherin-associated Src substrate
    • CAS
    • Catenin (cadherin associated protein) delta 1
    • Catenin delta
    • Catenin delta 1
    • Catenin delta-1
    • CTND1_HUMAN
    • CTNND
    • CTNND 1
    • CTNND1
    • KIAA0384
    • p120
    • P120 CAS
    • p120 catenin
    • P120 CTN
    • p120(cas)
    • p120(ctn)
    • P120CAS
    • P120CTN
    see all
  • FunctionBinds to and inhibits the transcriptional repressor ZBTB33, which may lead to activation of target genes of the Wnt signaling pathway (By similarity). May associate with and regulate the cell adhesion properties of both C- and E-cadherins. Implicated both in cell transformation by SRC and in ligand-induced receptor signaling through the EGF, PDGF, CSF-1 and ERBB2 receptors. Promotes GLIS2 C-terminal cleavage.
  • Tissue specificityExpressed in vascular endothelium.
  • Sequence similaritiesBelongs to the beta-catenin family.
    Contains 10 ARM repeats.
  • DomainA possible nuclear localization signal exists in all isoforms where Asp-626--631-Arg are deleted.
  • Post-translational
    modifications
    Phosphorylated by protein-tyrosine kinases. Dephosphorylated by PTPRJ.
  • Cellular localizationCytoplasm. Nucleus. Cell membrane. Interaction with GLIS2 promotes nuclear translocation (By similarity). NANOS1 induces its translocation from sites of cell-cell contact to the cytoplasm.
  • Information by UniProt

Recombinant Human delta 1 Catenin protein images

  • ab114472 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human delta 1 Catenin protein (ab114472)

ab114472 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114472.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"