Recombinant Human delta 2 Catenin protein (ab152307)

Overview

  • Product name
    Recombinant Human delta 2 Catenin protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ISLKERKTDYECTGSNATYHGAKGEHTSRKDAMTAQNTGISTLYRNSYGA PAEDIKHNQVSAQPVPQEPSRKDYETYQPFQNSTRNYDESFFEDQVHHRP PASEYTMHLG
    • Molecular weight
      38 kDa including tags
    • Amino acids
      1081 to 1190

Specifications

Our Abpromise guarantee covers the use of ab152307 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ARM-repeat protein
    • Catenin (cadherin associated protein) delta 2
    • catenin (cadherin-associated protein), delta 2 (neural plakophilin-related arm-repeat protein)
    • Catenin delta 2
    • Catenin delta-2
    • CTND2_HUMAN
    • CTNND 2
    • Ctnnd2
    • Delta catenin
    • Delta-catenin
    • GT 24
    • GT24
    • Neural plakophilin related arm repeat protein
    • Neural plakophilin related armadillo repeat protein
    • Neural plakophilin-related ARM-repeat protein
    • Neural plakophilin-related, Neurojungin
    • Neurojungin
    • NPRAP
    • T cell delta catenin
    see all
  • Function
    Functions as a transcriptional activator when bound to ZBTB33 (By similarity). May be involved in neuronal cell adhesion and tissue morphogenesis and integrity by regulating adhesion molecules.
  • Tissue specificity
    Predominantly expressed in brain.
  • Sequence similarities
    Belongs to the beta-catenin family.
    Contains 9 ARM repeats.
  • Post-translational
    modifications
    O-glycosylated.
    Phosphorylated upon DNA damage, probably by ATM or ATR.
  • Cellular localization
    Nucleus. Cell junction > adherens junction.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152307 stained with Coomassie Blue.

References

ab152307 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152307.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up