Recombinant Human DENND1A protein (ab153463)

Overview

  • Product name
    Recombinant Human DENND1A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSRIKQNPETTFEVYVEVAYPRTGGTLSDPEVQRQFPEDYSDQEVLQTL TKFCFPFYVDSLTVSQVGQNFTFVLTDIDSKQRFGFCRLSSGAKSCFCIL SYLPWFEVFYKLLNILADYTTKRQENQWNELLETLHKLPIPDPGVSVHLS VHSYFTVPDTRELPSIPENRNLTEYFVAVDVNNMLHLYASMLYERRILII CSKLSTLTACIHGSAAMLYPMYWQHVYIPVLPPHLLDYCCAPMPYLIGIH LSLMEKVRNMALDDVVILNVDTNTLETPFDDLQSLPNDVISSLKNRLKKV STTTGDGVARAFLKAQAAFFGSYRNALKIEPEEPITFCEEAFVSHYRSGA MRQFLQNATQLQLFKQFIDGRLDLLNSGEGFSDVFEEEINMGEYAGSDKL YHQWLSTVRKGSGAILNTVKTKANPAMKTVYKFAKDHAKMGIKEVKNRLK QKDIAENGCAPTPEEQLPKTAPSPLVEAKDPKLREDRRPITVHFGQVRPP RPHVVKRPKSNIAVEGRRTSVPSPEQNTIATPATLHILQKSITHFAAKFP TRGWTSSSH
    • Amino acids
      1 to 559
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153463 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Connecdenn
    • Connecdenn 1
    • DEN1A_HUMAN
    • DENN domain-containing protein 1A
    • DENN/MADD domain containing 1A
    • dennd1a
    • FAM31A
    • FLJ21129
    • FLJ38464
    • KIAA1608
    • OTTHUMP00000022090
    • Protein FAM31A
    • RP11 230L22.3
    see all
  • Function
    Guanine nucleotide exchange factor (GEF) for RAB35. May be involved in the clathrin-mediated endocytosis of synaptic vesicles.
  • Sequence similarities
    Contains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 uDENN domain.
  • Cellular localization
    Cell junction > synapse > presynaptic cell membrane. Cytoplasmic vesicle > clathrin-coated vesicle membrane. Also associated with uncoated vesicles.
  • Information by UniProt

Images

  • ab153463 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153463 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153463.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up