Recombinant Human DENND1B protein (ab165760)

Overview

  • Product name
    Recombinant Human DENND1B protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MAAAPREEKRWPQPVFSNPVVLWKFPEDFGDQEILQSVPKFCFPFDVERV SQNQVGQHFTFVLTDIESKQRFGFCRLTSGGTICLCILSYLPWFEVYYKL LNTLADYLAKELENDLNETLRSLYNHPVPKANTPVNLSVHSYFIAPDVTG LPTIPESRNLTEYFVAVDVNNMLQLYASMLHERRIVIISSKLSTLTACIH GSAALLYPMYWQHIYIPVLPPHLLDYCCAPMPYLIGIHSSLIERVKNKSL EDVVMLNVDTNTLESPFSDLNNLPSDVVSALKNKLKKQSTATGDGVARAF LRAQAALFGYYRDALRYKPGEPITFCEESFVKHRSSVMKQFLETAINLQL FKQFIDGRLAKLNAGRGFSDVFEEEITSGGFCGGKDKLQYDYPFSQ
    • Amino acids
      1 to 396
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165760 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C1ORF18
    • C1orf218
    • Chromosome 1 open reading frame 218
    • Connecdenn 2
    • DEN1B_HUMAN
    • DENN domain containing protein 1B
    • DENN domain-containing protein 1B
    • DENN MADD domain containing 1B
    • DENND1B
    • DKFZp547O0715
    • FAM31B
    • Family with sequence similarity 31 member B
    • FLJ20054
    • FLJ21179
    • FLJ33888
    • MGC103810
    • MGC27044
    • Protein FAM31B
    • RP11 53I24.2
    see all
  • Function
    Guanine nucleotide exchange factor (GEF) for RAB35. May function as a clathrin-associated sorting protein for RAB35, whereby during clathrin-mediated endocytosis, binds the AP-2 complex and inactived RAB35, then activates RAB35 for its subsequent function at endosomes.
  • Tissue specificity
    Highly expressed in dendritic and natural killer cells and at lower levels in other myeloid lineage cells and in pituitary. Significantly up-regulated in effector memory T cells as compared with naive T cells.
  • Sequence similarities
    Contains 1 dDENN domain.
    Contains 1 DENN domain.
    Contains 1 uDENN domain.
  • Post-translational
    modifications
    Isoform 5 is phosphorylated on Tyr-475, Tyr-484, Ser-514 and Ser-652.
  • Cellular localization
    Cytoplasm > cytosol. Cytoplasmic vesicle > clathrin-coated vesicle.
  • Information by UniProt

Images

  • ab165760 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165760 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165760.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up