Recombinant Human Density Regulated Protein (ab111640)

Overview

  • Product nameRecombinant Human Density Regulated Protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionO43583
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMAADISESSGADCKGDPRNSAKLDADYPLR VLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGI SEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTR VCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQE KWPEVDDDSIEDLGEVKK
    • Molecular weight24 kDa including tags
    • Amino acids1 to 198
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab111640 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab111640 is purified using conventional chromatography.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.04% DTT, 0.88% Sodium chloride
    Note: Contains 89% Tris-HCl buffer.

General Info

  • Alternative names
    • denr
    • DENR_HUMAN
    • Density regulated protein
    • Density-regulated protein
    • DRP
    • DRP1
    • DRP1 protein
    • Protein DRP1
    • SMAP-3
    • SMAP3
    • Smooth muscle cell associated protein 3
    • Smooth muscle cell-associated protein 3
    see all
  • FunctionMay be involved in the translation of target mRNAs by scanning and recognition of the initiation codon. Plays a role in the modulation of the translational profile of a subset of cancer-related mRNAs when recruited to the translational initiation complex by the oncogene MCTS1.
  • Tissue specificityHighly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. Weakly expressed in the lung and kidney.
  • Sequence similaritiesBelongs to the DENR family.
    Contains 1 SUI1 domain.
  • Information by UniProt

Recombinant Human Density Regulated Protein images

  • 15% SDS-PAGE analysis of ab111640 (3 µg)

References for Recombinant Human Density Regulated Protein (ab111640)

ab111640 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab111640.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"