Overview

  • Product name
    Recombinant Human DENTT protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MDRPDEGPPAKTRRLSSSESPQRDPPPPPPPPPLLRLPLPPPQQRPRLQE ETEAAQVLADMRGVGLGPALPPPPPYVILEEGGIRAYFTLGAECPGWDST IESGYGEAPPPTESLEALPTPEASGGSLEIDFQVVQSSSFGGEGALETCS AVGWAPQRLVDPKSKEEAIIIVEDEDEDERESMRSSRRRRRRRRRKQRKV KRESRERNAERMESILQALEDIQLDLEAVNIKAGKAFLRLKRKFIQMRRP FLERRDLIIQHIPGFWVKAFLNHPRISILINRRDEDIFRYLTNLQVQDLR HISMGYKMKLYFQTNPYFTNMVIVKEFQRNRSGRLVSHSTPIRWHRGQEP QARRHGNQDASHSFFSWFSNHSLPEADRIAEIIKNDLWVNPLRYYLRERG SRIKRKKQEMKKRKTRGRCEVVIMEDAPDYYAVEDIFSEISDIDETIHDI KISDFMETTDYFETTDNEITDINENICDSENPDHNEVPNNETTDNNESAD DHETTDNNESADDNNENPEDNNKNTDDNEENPNNNENTYGNNFFKGGFWG SHGNNQDSSDSDNEADEASDDEDNDGNEGDNEGSDDDGNEGDNEGSDDDD RDIEYYEKVIEDFDKDQADYEDVIEIISDESVEEEGIEEGIQQDEDIYEE GNYEEEGSEDVWEEGEDSDDSDLEDVLQVPNGWANPGKRGKTG
    • Amino acids
      1 to 693
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163766 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CASK interacting nucleosome assembly protein
    • CDA1
    • Cell division autoantigen 1
    • CINAP
    • CTCL
    • CTCL tumor antigen se20 4
    • CTCL-associated antigen se20-4
    • Cutaneous T cell lymphoma associated antigen se20 4
    • Cutaneous T cell lymphoma associated tumor antigen se20 4
    • Cutaneous T-cell lymphoma-associated antigen se20-4
    • Differentially Expressed Nucleolar TGF beta1 Target
    • Differentially Expressed Nucleolar TGF beta1 Target protein
    • Differentially-expressed nucleolar TGF-beta1 target protein
    • HRIHFB2216
    • NP79
    • Nuclear protein of 79 kDa
    • RP1 290F12.2
    • SE20 4
    • SE204
    • Testis specific protein Y encoded like 2
    • testis-specific protein Y encoded-like 2
    • Testis-specific Y-encoded-like protein 2
    • TSPX
    • TSPY like 2
    • TSPY like protein 2
    • TSPY-like protein 2
    • TSPYL2
    • TSYL2_HUMAN
    see all
  • Function
    Part of the CASK/TRB1/TSPYL2 transcriptional complex which modulates gene expression in response to neuronal synaptic activity, probably by facilitating nucleosome assembly. May inhibit cell proliferation by inducing p53-dependent CDKN1A expression.
  • Tissue specificity
    Ubiquitously expressed, with highest levels in brain, testis and heart, and lowest levels in liver and pancreas.
  • Sequence similarities
    Belongs to the nucleosome assembly protein (NAP) family.
  • Post-translational
    modifications
    Phosphorylation at Ser-20 and/or Thr-340 impairs function on cell proliferation.
  • Cellular localization
    Nucleus. Cytoplasm. Enriched in transcriptionally active regions of chromatin in neurons.
  • Information by UniProt

Images

  • ab163766 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163766 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163766.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up