Recombinant Human DEPDC1 protein (ab153404)

Overview

  • Product name
    Recombinant Human DEPDC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GSENVDDNNQLFRFPATSPLKTLPRRYPELRKNNIENFSKDKDSIFKLRN LSRRTPKRHGLHLSQENGEKIKHEIINEDQENAIDNRELSQEDV
    • Amino acids
      93 to 186
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153404 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5830484J08Rik
    • Cell cycle control protein SDP35
    • DEP domain containing 1
    • DEP domain containing protein 1A
    • DEP domain-containing protein 1A
    • DEP.8
    • DEP1A_HUMAN
    • DEPDC 1
    • DEPDC 1A
    • DEPDC1
    • DEPDC1-V2
    • Depdc1a
    • FLJ20354
    • SDP 35
    • SDP35
    see all
  • Function
    May be involved in transcriptional regulation as a transcriptional corepressor. The DEPDC1A-ZNF224 complex may play a critical role in bladder carcinogenesis by repressing the transcription of the A20 gene, leading to transport of NF-KB protein into the nucleus, resulting in suppression of apoptosis of bladder cancer cells.
  • Tissue specificity
    Expressed in testis. Up-regulated in bladder cancer cells (at protein level).
  • Sequence similarities
    Contains 1 DEP domain.
    Contains 1 Rho-GAP domain.
  • Cellular localization
    Nucleus. Co-localizes with ZNF224 at the nucleus.
  • Information by UniProt

Images

  • ab153404 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153404 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153404.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up