Overview

  • Product name
    Recombinant Human DERA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMSAHNRGTELDLSWISKIQVNHPAVLRRAE QIQARRTVKKEWQAAWLLKAVTFIDLTTLSGDDTSSNIQRLCYKAKYPIR EDLLKALNMHDKGITTAAVCVYPARVCDAVKALKAAGCNIPVASVAAGFP AGQTHLKTRLEEIRLAVEDGATEIDVVINRSLVLTGQWEALYDEIRQFRK ACGEAHLKTILATGELGTLTNVYKASMIAMMAGSDFIKTSTGKETVNATF PVAIVMLRAIRDFFWKTGNKIGFKPAGGIRSAKDSLAWLSLVKEELGDEW LKPELFRIGASTLLSDIERQIYHHVTGRYAAYHDLPMS
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 318
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab113155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 90 % SDS-PAGE.
    ab113155 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.58% Sodium chloride, 0.02% DTT

General Info

  • Alternative names
    • Deoxyriboaldolase
    • 2 deoxyribose 5 phosphate aldolase homolog C. elegans
    • CGI 26
    • CGI26
    • DEOC
    • DEOC_HUMAN
    • Deoxyriboaldolase
    • Deoxyribose phosphate aldolase like
    • DERA
    • Phosphodeoxyriboaldolase
    • Putative deoxyribose phosphate aldolase
    • Putative deoxyribose-phosphate aldolase
    see all
  • Pathway
    Carbohydrate degradation; 2-deoxy-D-ribose 1-phosphate degradation; D-glyceraldehyde 3-phosphate and acetaldehyde from 2-deoxy-alpha-D-ribose 1-phosphate: step 2/2.
  • Sequence similarities
    Belongs to the deoC/fbaB aldolase family. DeoC type 2 subfamily.
  • Information by UniProt

Recombinant Human DERA protein images

  • 15% SDS-PAGE showing ab113155 (3 µg) at approximately 37.3 kDa.

References for Recombinant Human DERA protein (ab113155)

ab113155 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab113155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up