Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDIGDWFRSIPAITRYWFAATVAVPLVGKLGLISPAYLFLWPEAFLYRF QIWRPITATFYFPVGPGTGFLYLVNLYFLYQYSTRLETGAFDGRPADYLF MLLFNWICIVITGLAMDMQLLMIPLIMSVLYVWAQLNRDMIVSFWFGTRF KACYLPWVILGFNYIIGGSVINELIGNLVGHLYFFLMFRYPMDLGGRNFL STPQFLYRWLPSRRGGVSGFGVPPASMRRAADQNGGGGRHNWGQGFRLGD Q
    • Amino acids
      1 to 251
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163984 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DER 1
    • DER1
    • Der1 like protein 1
    • DERL 1
    • Derlin 1
    • DERtrin 1
    see all
  • Relevance
    Derlin 1 is a channel-like protein found in the endoplasmic reticulum (ER) membrane. It is specifically required for the degradation of misfolded ER luminal proteins. Derlin 1 participates in the transfer of misfolded proteins from the ER to the cytosol, where they are destroyed by the proteasome in a ubiquitin-dependent manner. It may act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol and then transferring them to the ATPase VCP complex, which translocates and ubiquitinates misfolded proteins. In the case of infection by cytomegaloviruses, derlin 1 plays a central role in export from the ER and subsequent degradation of MHC class I heavy chains via its interaction with US11 viral protein, which recognizes and associates with MHC class I heavy chains. Derlin 1 also participates in the degradation of misfolded cytomegalovirus US2 protein.
  • Cellular localization
    Endoplasmic reticulum; multi pass membrane protein.

Images

  • ab163984 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163984 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163984.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up