Recombinant Human Desmocollin 3 protein (ab158320)

Overview

  • Product name
    Recombinant Human Desmocollin 3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CKPKMGYTDILAVDPDEPVHGAPFYFSLPNTSPEISRLWSLTKVNDTAAR LSYQKNAGFQEYTIPITVKDRAGQAATKLLRVNLCECTHPTQCRATSRST
    • Amino acids
      585 to 684
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin family member 3
    • CDHF3
    • desmocollin 3a/3b
    • Desmocollin 4
    • Desmocollin-3
    • Desmocollin-4
    • Desmocollin3
    • Desmocollin4
    • DSC
    • DSC1
    • DSC2
    • DSC3
    • DSC3_HUMAN
    • DSC4
    • HT CP
    • HT-CP
    • HTCP
    see all
  • Function
    Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. May contribute to epidermal cell positioning (stratification) by mediating differential adhesiveness between cells that express different isoforms.
  • Tissue specificity
    Epidermis, buccal mucosa, esophagus and cervix.
  • Involvement in disease
    Defects in DSC3 are the cause of hypotrichosis and recurrent skin vesicles (HRSV) [MIM:613102]. A disorder characterized by hypotrichosis and the appearance of recurrent skin vesicle formation. Affected individuals show sparse and fragile hair on scalp, as well as absent eyebrows and eyelashes. Vesicles filled with thin, watery fluid are observed on the scalp and skin of most of the boby. Mucosal vesicles are absent.
  • Sequence similarities
    Contains 5 cadherin domains.
  • Domain
    Calcium may be bound by the cadherin-like repeats.
  • Cellular localization
    Cell membrane. Cell junction > desmosome.
  • Information by UniProt

Images

  • ab158320 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up