Recombinant Human Desmoglein 1 protein (ab114443)

Overview

  • Product name
    Recombinant Human Desmoglein 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MDWSFFRVVAMLFIFLVVVEVNSEFRIQVRDYNTKNGTIKWHSIRRQKRE WIKFAAACREGEDNSKRNPIAKIHSDCAANQQVTYRISGVGIDQPPYGIF VINQKTGEINITSIVDREVTPFFIIYCRALNSMGQDLERPLELRVRVLDI NDNPPVFSMATFAGQIEENSNANTLVMILNATDADEPNNLNSKIAFKIIR QEPSDSPMFIINRNTGEIRTMNNFLDREQYGQYALAVRGSDRDGGADGMS AECECNIKILDVNDNIPYMEQSSYTIEIQENTLNSNLLEIRVIDLDEEFS ANWMAVIFFISGNEGNWFEIEMNERTNVGILKVVKPLDYEAMQSLQLSIG VRNKAEFHHSIMSQYKLKASAISVTVLNVIEGPVFRPGSKTYVVTGNMGS NDKVGDFVATDLDTGRPSTTVRYVMGNNPADLLAVDSRTGKLTLKNKVTK EQYNMLGGKYQGTILSIDDNLQRTCTGTININIQSFGNDDRTNTEPNTKI TTNTGRQESTSSTNYDTSTTSTDSSQVYSSEPGNGAKDLLSDNVHFGPAG IGLLIMGFLVLGLVPFLMICCDCGGAPRSAAGFEPVPECSDGAIHSWAVE GPQPEPRDITTVIPQIPPDNANIIECIDNSGVYTNEYGGREMQDLGGGER MTGFELTEGVKTSGMPEICQEYSGTLRRNSMRECREGGLNMNFMESYFCQ KAYAYADEDEGRPSNDCLLIYDIEGVGSPAGSVGCCSFIGEDLDDSFLDT LGPKFKKLADISLGKESYPDLDPSWPPQSTEPVCLPQETEPVVSGHPPIS PHFGTTTVISESTYPSGPGVLHPKPILDPLGYGNVTVTESYTTSDTLKPS VHVHDNRPASNVVVTERVVGPISGADLHGMLEMPDLRDGSNVIVTERVIA PSSSLPTSLTIHHPRESSNVVVTERVIQPTSGMIGSLSMHPELANAHNVI VTERVVSGAGVTGISGTTGISGGIGSSGLVGTSMGAGSGALSGAGISGGG IGLSSLGGTASIGHMRSSSDHHFNQTIGSASPSTARSRITKYSTVQYSK
    • Molecular weight
      142 kDa including tags
    • Amino acids
      1 to 1049

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114443 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cadherin family member 4
    • CDHF4
    • Desmoglein-1
    • Desmosomal glycoprotein 1
    • DG1
    • DGI
    • DSG
    • DSG1
    • DSG1_HUMAN
    • EPKHE
    • EPKHIA
    • Pemphigus foliaceus antigen
    • PPKS1
    • SPPK1
    see all
  • Function
    Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.
  • Tissue specificity
    Epidermis, tongue, tonsil and esophagus.
  • Involvement in disease
    Defects in DSG1 are the cause of palmoplantar keratoderma striate type 1 (SPPK1) [MIM:148700]; also known as keratosis palmoplantaris striata I. SPPK1 is a dermatoligical disorder characterized by thickening of the skin on the palms and soles, and longitudinal hyperkeratotic lesions on the palms, running the length of each finger.
  • Sequence similarities
    Contains 4 cadherin domains.
  • Domain
    Calcium may be bound by the cadherin-like repeats.
  • Cellular localization
    Cell membrane. Cell junction > desmosome.
  • Information by UniProt

Recombinant Human Desmoglein 1 protein images

  • ab114443 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.

References for Recombinant Human Desmoglein 1 protein (ab114443)

ab114443 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114443.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up