Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO60443
    • SpeciesHuman
    • SequenceMFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPK YQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVK LNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEG RNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN VTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRI DSVYLDPLVFREFAFIDMPDAAHGISSQDGPLSVLKQATLLLERNFHPFA ELPEPQQTALSDIFQAVLFDDELLMVLEPVCDDLVSGLSPTVAVLGELKP RQQQDLVAFLQLVGCSLQGGCPGPEDAGSKQLFMTAYFLVSALAEMPDSA AALLGTCCKLQIIPTLCHLLRALSDDGVSDLEDPTLTPLKDTERFGIVQR LFASADISLERLKSSVKAVILKDSKVFPLLLCITLNGLCALGREHS
    • Molecular weight81 kDa including tags
    • Amino acids1 to 496

Specifications

Our Abpromise guarantee covers the use of ab116824 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310037D07Rik
    • 4932441K13Rik
    • Deafness, autosomal dominant 5
    • Deafness, autosomal dominant 5 protein
    • DFNA5
    • DFNA5 gene
    • DFNA5_HUMAN
    • Dfna5h
    • EG14210
    • Fin15
    • ICERE 1
    • ICERE-1
    • Inversely correlated with estrogen receptor expression 1
    • Non-syndromic hearing impairment protein 5
    • Nonsyndromic hearing impairment protein
    see all
  • Tissue specificityExpressed in cochlea. Low level of expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas, with highest expression in placenta.
  • Involvement in diseaseDefects in DFNA5 are the cause of deafness autosomal dominant type 5 (DFNA5) [MIM:600994]. DFNA5 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similaritiesBelongs to the gasdermin family.
  • Information by UniProt

Recombinant Human DFNA5 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116824 at approximately 80.63 kDa.

References for Recombinant Human DFNA5 protein (ab116824)

ab116824 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116824.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"