Recombinant Human DFNA5/GSDME protein (ab158278)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      SQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQ KITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGN
    • Amino acids
      111 to 200
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158278 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2310037D07Rik
    • 4932441K13Rik
    • Deafness, autosomal dominant 5
    • Deafness, autosomal dominant 5 protein
    • DFNA5
    • DFNA5 gene
    • DFNA5_HUMAN
    • Dfna5h
    • EG14210
    • Fin15
    • ICERE 1
    • ICERE-1
    • Inversely correlated with estrogen receptor expression 1
    • Non-syndromic hearing impairment protein 5
    • Nonsyndromic hearing impairment protein
    see all
  • Tissue specificity
    Expressed in cochlea. Low level of expression in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas, with highest expression in placenta.
  • Involvement in disease
    Defects in DFNA5 are the cause of deafness autosomal dominant type 5 (DFNA5) [MIM:600994]. DFNA5 is a form of sensorineural hearing loss. Sensorineural deafness results from damage to the neural receptors of the inner ear, the nerve pathways to the brain, or the area of the brain that receives sound information.
  • Sequence similarities
    Belongs to the gasdermin family.
  • Information by UniProt

Images

  • ab158278 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158278 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158278.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up