Recombinant Human DGCR14 protein (ab159968)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RVTENLASLTPKGLSPAMSPALQRLVSRTASKYTDRALRASYTPSPARST HLKTPASGLQTPTSTPAPGSATRTPLTQDPASITDNLLQLPARRKASDFF
    • Amino acids
      377 to 476
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159968 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGC14_HUMAN
    • DGCR13
    • DGCR14
    • DGS H
    • DGS I
    • DGS-H
    • DGSH
    • DGSI
    • DiGeorge syndrome critical region 13
    • DiGeorge syndrome critical region 14
    • DiGeorge syndrome critical region gene 14
    • DiGeorge syndrome critical region gene DGSI
    • DiGeorge syndrome critical region protein 14
    • DiGeorge syndrome gene H
    • DiGeorge syndrome gene I
    • DiGeorge syndrome protein H
    • ES2
    • ES2 protein
    • Es2el
    • Protein DGCR14
    • Protein ES2
    see all
  • Function
    May be involved in pre-mRNA splicing.
  • Tissue specificity
    Highly expressed in heart, brain and skeletal muscle. Detected at low levels in placenta.
  • Sequence similarities
    Belongs to the DGCR14 family.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab159968 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159968 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159968.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up