Recombinant Human DGCR6L protein (ab164743)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MERYAAALEEVADGARQQERHYQLLSALQSLVKELPSSFQQRLSYTTLSD LALALLDGTVFEIVQGLLEIQHLTEKSLYNQRLRLQNEHRVLRQALRQKH QEAQQACRPHNLPVVQAAQQRELEAVEHRIREEQRAMDQKIILELDRKVA DQQSTLEKAGVAGFYVTTNPQELMLQMNLLELIRKLQQRGCRAGNAALGL GGPWQSPAAQCDQKGSPVPP
    • Amino acids
      1 to 220
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGC6L_HUMAN
    • DGCR6L
    • DiGeorge syndrome critical region 6-like protein
    • Protein DGCR6L
  • Function
    May play a role in neural crest cell migration into the third and fourth pharyngeal pouches.
  • Tissue specificity
    Widely expressed in fetal and adult tissues. Highest expression in liver, heart and skeletal muscle. Lower levels in pancreas and placenta. Weak expression in brain.
  • Sequence similarities
    Belongs to the gonadal family.
  • Cellular localization
    Nucleus. Predominantly nuclear.
  • Information by UniProt

Images

  • ab164743 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up