Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGY EGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVS CYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLD WDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTL KDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKA LPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYI LNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANL PVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRW SVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFYIMREKYPEKFNS RMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLS DKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWVQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
    • Molecular weight
      107 kDa including tags
    • Amino acids
      1 to 735
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114613 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 80 kDa diacylglycerol kinase
    • DAG kinase alpha
    • DAGK
    • DAGK1
    • DGK alpha
    • DGK-alpha
    • dgkA
    • DGKA_HUMAN
    • Diacylglycerol kinase alpha
    • Diacylglycerol kinase, alpha 80kDa
    • Diglyceride kinase alpha
    • MGC12821
    • MGC42356
    • OTTHUMP00000242836
    • OTTHUMP00000242955
    • OTTHUMP00000244046
    see all
  • Function
    Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
  • Tissue specificity
    Lymphocytes and oligodendroglial cells.
  • Sequence similarities
    Belongs to the eukaryotic diacylglycerol kinase family.
    Contains 1 DAGKc domain.
    Contains 2 EF-hand domains.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
  • Information by UniProt

Recombinant Human DGKA protein images

  • ab114613 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References for Recombinant Human DGKA protein (ab114613)

ab114613 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up