Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGY EGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVS CYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLD WDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTL KDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKA LPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHC VWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKT SQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYI LNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANL PVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRW SVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFYIMREKYPEKFNS RMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVL NIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLS DKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGE PWVQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS
    • Molecular weight
      107 kDa including tags
    • Amino acids
      1 to 735
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab114613 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    ab114613 is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.79% Tris HCl, 0.3% Glutathione

General Info

  • Alternative names
    • 80 kDa diacylglycerol kinase
    • DAG kinase alpha
    • DAGK
    • DAGK1
    • DGK alpha
    • DGK-alpha
    • dgkA
    • DGKA_HUMAN
    • Diacylglycerol kinase alpha
    • Diacylglycerol kinase, alpha 80kDa
    • Diglyceride kinase alpha
    • MGC12821
    • MGC42356
    • OTTHUMP00000242836
    • OTTHUMP00000242955
    • OTTHUMP00000244046
    see all
  • Function
    Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity.
  • Tissue specificity
    Lymphocytes and oligodendroglial cells.
  • Sequence similarities
    Belongs to the eukaryotic diacylglycerol kinase family.
    Contains 1 DAGKc domain.
    Contains 2 EF-hand domains.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
  • Information by UniProt

Images

  • ab114613 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab114613 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114613.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up