Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      CKQQCGCQPKLCDYRCIWCQKTVHDECMKNSLKNEKCDFGEFKNLIIPPS YLTSINQMRKDKKTDYEVLASKLGKQWTPLIILANSRSGTNMGEGLLGEF
    • Amino acids
      141 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AHUS7
    • DAG kinase epsilon
    • DAGK 5
    • DAGK 6
    • DAGK5
    • DAGK6
    • DGK
    • DGK epsilon
    • DGK-epsilon
    • DGKE
    • DGKE_HUMAN
    • Diacylglycerol kinase epsilon
    • Diacylglycerol kinase epsilon 64kDa
    • Diglyceride kinase epsilon
    • NPHS7
    see all
  • Function
    Highly selective for arachidonate-containing species of diacylglycerol (DAG). May terminate signals transmitted through arachidonoyl-DAG or may contribute to the synthesis of phospholipids with defined fatty acid composition.
  • Tissue specificity
    Expressed predominantly in testis.
  • Sequence similarities
    Belongs to the eukaryotic diacylglycerol kinase family.
    Contains 1 DAGKc domain.
    Contains 2 phorbol-ester/DAG-type zinc fingers.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160074 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up