Overview

  • Product name
    Recombinant Human DGKG protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGEERWVSLTPEEFDQLQKYSEYSSKKIKDALTEFNEGGSLKQYDPHEPI SYDVFKLFMRAYLEVDLPQPLSTHLFLAFSQKPRHETSDHPTEGASNSEA NSADTNIQNADNATKADEACAPDTESNMAEKQAPAEDQVAATPLEPPVPR SSSSESPVVYLKDVVCYLSLLETGRPQDKLEFMFRLYDSDENGLLDQAEM DCIVNQMLHIAQYLEWDPTELRPILKEMLQGMDYDRDGFVSLQEWVHGGM TTIPLLVLLGMDDSGSKGDGRHAWTMKHFKKPTYCNFCHIMLMGVRKQGL CCTYCKYTVHERCVSRNIPGCVKTYSKAKRSGEVMQHAWVEGNSSVKCDR CHKSIKCYQSVTARHCVWCRMTFHRKCELSTLCDGGELRDHILLPTSICP ITRDRPGEKSDGCVSAKGELVMQYKIIPTPGTHPLLVLVNPKSGGRQGER LNFFRDTPDFRVLACGGDGTVGWILDCIDKANFAKHPPVAVLPLGTGNDL ARCLRWGGGYEGGSLTKILKDIEQSPLVMLDRWHLEVIPREEVENGDQVP YSIMNNYFSIGVDASIAHRFHVMREKHPEKFNSRMKNKLWYFEFGTSETF AATCKKLHDHIELECDGVGVDLSNIFLEGIAILNIPSMYGGTNLWGENKK NRAVIRESRKGVTDPKELKFCVQDLSDQLLEVVGLEGAMEMGQIYTGLKS AGRRLAQCASVTIRTNKLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPP QKSSFFSLRRKSRSKD
    • Amino acids
      1 to 766
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158261 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DGKG
    • DAG kinase gamma
    • DAGK3
    • DGK gamma
    • Diacylglycerol kinase gamma
    • diacylglycerol kinase gamma 90kDa
    • Diglyceride kinase
    • Diglyceride kinase gamma
    see all
  • Relevance
    DGKG (Diacylglycerol kinase gamma ) reverses the normal flow of glycerolipid biosynthesis by phosphorylating diacylglycerol back to phosphatidic acid. This enzyme initiates resynthesis of phosphoinositides consumed by phospholipase C during cellular signal transduction. DGK gamma is one of multiple DGK isozymes found in animal cells. It is expressed abundantly in the human retina and to a much lesser extent in the brain. Other tissues contain extremely low levels.
  • Cellular localization
    Cell Membrane and Cytoplasmic.

Images

  • ab158261 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158261 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158261.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up