Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHD IPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTG VNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVA RAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVV GRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLL NPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGM KESPVIPLSESELLADILEEVRKAIGVTFPQDKR
    • Amino acids
      1 to 334
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162137 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-dihydrobenzene-1
    • 2-diol dehydrogenase
    • 2DD
    • 3 deoxyglucosone reductase
    • D xylose 1 dehydrogenase
    • D xylose NADP dehydrogenase
    • D-xylose 1-dehydrogenase
    • D-xylose-NADP dehydrogenase
    • DHDH
    • DHDH_HUMAN
    • dihydrodiol dehydrogenase (dimeric)
    • Dimeric dihydrodiol dehydrogenase
    • HUM2DD
    • Trans-1
    see all
  • Tissue specificity
    Small intestine.
  • Sequence similarities
    Belongs to the Gfo/Idh/MocA family.
  • Information by UniProt

Images

  • ab162137 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162137 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162137.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up