Overview

  • Product name
    Recombinant Human DHRS3 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MVWKRLGALVMFPLQMIYLVVKAAVGLVLPAKLRDLSRENVLITGGGRGI GRQLAREFAERGARKIVLWGRTEKCLKETTEEIRQMGTECHYFICDVGNR EEVYQTAKAVREKVGDITILVNNAAVVHGKSLMDSDDDALLKSQHINTLG QFWTTKAFLPRMLELQNGHIVCLNSVLALSAIPGAIDYCTSKASAFAFME SLTLGLLDCPGVSATTVLPFHTSTEMFQGMRVRFPNLFPPLKPETVARRT VEAVQLNQALLLLPWTMHALVILKSILPQAALEEIHKFSGTYTCMNTFKG RT
    • Amino acids
      1 to 302
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160402 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DD83.1
    • Dehydrogenase/reductase (SDR family) member 3
    • DHRS3
    • DHRS3_HUMAN
    • EC 1.1.1.300
    • MGC125166
    • RDH17
    • Retinal short chain dehydrogenase/reductase 1
    • Retinal short-chain dehydrogenase/reductase 1
    • retSDR1
    • Rsdr1
    • SDR family, member 3
    • SDR1
    • SDR16C1
    • Short-chain dehydrogenase/reductase 3
    • Short-chain dehydrogenase/reductase family, member 3
    see all
  • Function
    Catalyzes the reduction of all-trans-retinal to all-trans-retinol in the presence of NADPH.
  • Tissue specificity
    Widely expressed with highest levels found in heart, placenta, lung, liver, kidney, pancreas, thyroid, testis, stomach, trachea and spinal cord. Lower levels found in skeletal muscle, intestine and lymph node. No expression detected in brain. In the retina, expressed in cone but not rod outer segments.
  • Sequence similarities
    Belongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • ab160402 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160402 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160402.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up