Overview

  • Product nameRecombinant Human DHRS4 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceEscherichia coli
  • Amino Acid Sequence
    • AccessionQ9BTZ2
    • SpeciesHuman
    • SequenceMGSSHHHHHHSSGLVPRGSHMGSHMHKAGLLGLCARAWNSVRMASSGMTR RDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQQNVDQAVATL QGEGLSVTGTVCHVGKAEDRERLVATAVKLHGGIDILVSNAAVNPFFGSI MDVTEEVWDKTLDINVKAPALMTKAVVPEMMHKAGLLGLCARAWNSVRMA SSGMTRRDPLANKVALVTASTDGIGFAIARRLAQDGAHVVVSSRKQEKRG GGSVVIVSSIAAFSPSPGFSPYNVSKTALLGLTKTLAIELAPRNIRVNCL APGLIKTSFSRMLWMDKEKEESMKETLRIRRLGEPEDCAGIVSFLCSEDA SYITGETVVVGGGTPSRL
    • Molecular weight32 kDa including tags
    • Amino acids1 to 278
    • TagsHis tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab116155 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    MALDI-TOF
  • Purity> 85 % SDS-PAGE.
    ab116155 was purified using conventional chromatography techniques.
  • FormLiquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.32% Tris HCl, 20% Glycerol, 0.02% DTT

General Info

  • Alternative names
    • AI043103
    • AI790593
    • Carbonyl reductase
    • CR
    • D14Ucla2
    • Dehydrogenase/reductase SDR family member 4
    • Dhrs4
    • DHRS4_HUMAN
    • humNRDR
    • mouNRDR
    • NADPH dependent carbonyl reductase/NADP retinol dehydrogenase
    • NADPH dependent retinol dehydrogenase/reductase
    • NADPH-dependent carbonyl reductase/NADP-retinol dehydrogenase
    • NADPH-dependent retinol dehydrogenase/reductase
    • NDRD
    • NRDR
    • Peroxisomal short chain alcohol dehydrogenase
    • Peroxisomal short-chain alcohol dehydrogenase
    • PHCR
    • PRO1800
    • PSCD
    • RRD
    • SCAD-SRL
    • SCADSRL
    • Short chain dehydrogenase/reductase family member 4
    • Short-chain dehydrogenase/reductase family member 4
    • UNQ851
    see all
  • FunctionReduces all-trans-retinal and 9-cis retinal. Can also catalyze the oxidation of all-trans-retinol with NADP as co-factor, but with much lower efficiency. Reduces alkyl phenyl ketones and alpha-dicarbonyl compounds with aromatic rings, such as pyrimidine-4-aldehyde, 3-benzoylpyridine, 4-benzoylpyridine, menadione and 4-hexanoylpyridine. Has no activity towards aliphatic aldehydes and ketones.
  • Tissue specificityIsoform 1 is predominantly expressed in normal cervix (at protein level). Isoform 4 is expressed in some neoplastic cervical tissues, but not in normal cervix (at protein level). Isoform 5 and isoform 6 are expressed in a few neoplastic cervical tissues.
  • Sequence similaritiesBelongs to the short-chain dehydrogenases/reductases (SDR) family.
  • Cellular localizationPeroxisome. Isoform 1 is peroxisomal, while isoform 4 is not.
  • Information by UniProt

Recombinant Human DHRS4 protein images

  • 15% SDS-PAGE showing ab116155 at approximately 32.1kDa (3µg).

References for Recombinant Human DHRS4 protein (ab116155)

ab116155 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116155.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"