Overview

  • Product name
    Recombinant Human DHX16 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      RKAITAGYFYHTARLTRSGYRTVKQQQTVFIHPNSSLFEQQPRWLLYHEL VLTTKEFMRQVLEIESSWLLEVAPHYYKAKELEDPHAKKMPKKIGKTREE LG
    • Amino acids
      940 to 1041
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160034 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2410006N22Rik
    • ATP-dependent RNA helicase #3
    • ATP-dependent RNA helicase 3
    • DAQB-47P19.12
    • DBP 2
    • DBP2
    • DDX 16
    • DDX16
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16
    • DEAD/H box 16
    • DEAH (Asp-Glu-Ala-His) box polypeptide 16
    • DEAH box protein
    • DEAH box protein 16
    • DEAH-box protein
    • DEAH-box protein 16
    • DHX16
    • DHX16_HUMAN
    • fa91b12
    • KIAA0577
    • mKIAA0577
    • PRO2014
    • PRP 8
    • Prp2
    • PRP8
    • PRPF2
    • Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16
    • RNA helicase
    • wu:fa91b12
    • zgc:55590
    see all
  • Function
    Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DEAH subfamily. DDX16/PRP8 sub-subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160034 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160034 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160034.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up