Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MEEEGLECPNSSSEKRYFPESLDSSDGDEEEVLACEDLELNPFDGLPYSS RYYKLLKEREDLPIWKEKYSFMENLLQNQIVIVSGDAKCGKSAQVPQWCA EYCLSIHYQHGGVICTQVHKQTVVQLALRVADEMDVNIGHEVGYVIPFEN CCTNETILRYCTDDMLQREMMSNPFLGSYGVIILDDIHERSIATDVLLGL LKDVLLARPELKLIINSSPHLISKLNSYYGNVPVIEVKNKHPVEVVYLSE AQKDSFESILRLIFEIHHSGEKGDIVVFLACEQDIEKVCETVYQGSNLNP DLGELVVVPLYPKEKCSLFKPLDETEKRCQVYQRRVVLTTSSGEFLIWSN SVRFVIDVGVERRKVYNPRIRANSLVMQPISQSQAEIRKQILGSSSSGKF FCLYTEEFASKDMTPLKPAEMQEANLTSMVLFMKRIDIAGLGHCDFMNRP APESLMQALEDLDYLAALDNDGNLSEFGIIMSEFPLDPQLSKSILASCEF DCVDEVLTIAAMVTAPNCFSHVPHGAEEAALTCWKTFLHPEGDHFTLISI YKAYQDTTLNSSSEYCVEKWCRDYFLNCSALRMADVIRAELLEIIKRIEL PYAEPAFGSKENTLNIKKALLSGYFMQIARDVDGSGNYLMLTHKQVAQLH PLSGYSITKKMPEWVLFHKFSISENNYIRITSEISPELFMQLVPQYYFSN LPPSESKDILQQVVDHLSPVSTMNKEQQMCETCPETEQRCTLQ
    • Amino acids
      1 to 743
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163208 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 3110079L04Rik
    • AA408140
    • Ddx32
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 32
    • DEAD/H box 32
    • DEAD/H helicase like protein 1
    • DEAD/H helicase-like protein 1
    • DEAH (Asp-Glu-Ala-His) box polypeptide 32
    • DEAH box protein 32
    • DHLP1
    • DHX32
    • DHX32_HUMAN
    • Helicase DDX32
    • HuDDX32
    • Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
    see all
  • Tissue specificity
    Expressed in lymphoid tissues (at protein level). Expressed in brain, heart, skeletal muscle, colon, thymus, spleen, kidney, liver, small intestine, placenta, lung, lymphoid tissues and blood leukocytes.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DEAH subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus. Mitochondrion.
  • Information by UniProt

Images

  • ab163208 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163208 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163208.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up