Overview

  • Product name
    Recombinant Human DHX38 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      YSSEDYVRRREQHLHKQKQKRISAQRRQINEDNERWETNRMLTSGVVHRL EVDEDFEEDNAAKVHLMVHNLVPPFLDGRIVFTKQPEPVIPVKDATSDLA IIARKGSQT
    • Amino acids
      342 to 450
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160651 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase DHX38
    • ATP-dependent RNA helicase DHX38
    • DDX38
    • DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 38
    • DEAH (Asp-Glu-Ala-His) box polypeptide 38
    • DEAH box protein 38
    • DHX38
    • KIAA0224
    • Pre mRNA splicing factor ATP dependent RNA helicase PRP16
    • Pre-mRNA splicing factor 16
    • Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16
    • Prp16
    • PRP16 homolog of S.cerevisiae; pre-mRNA splicing factor ATP-dependent RNA helicase PRP16
    • PRP16_HUMAN
    • PRPF16
    see all
  • Function
    Probable ATP-binding RNA helicase involved in pre-mRNA splicing.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DEAH subfamily. PRP16 sub-subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160651 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160651 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160651.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up