Overview

  • Product name
    Recombinant Human DHX58 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MELRSYQWEVIMPALEGKNIIIWLPTGAGKTRAAAYVAKRHLETVDGAKV VVLVNRVHLVTQHGEEFRRMLDGRWTVTTLSGDMGPRAGFGHLARCHDLL ICTAELLQMALTSPEEEEHVELTVFSLIVVDECHHTHKDTVYNVIMSQYL ELKLQRAQPLPQVLGLTASPGTGGASKLDGAINHVLQLCANLDTWCIMSP QNCCPQLQEHSQQPCKQYNLCHRRSQDPFGDLLKKLMDQIHDHLEMPELS RKFGTQMYEQQVVKLSEAAALAGLQEQRVYALHLRRYNDALLIHDTVRAV DALAALQDFYHREHVTKTQILCAERRLLALFDDRKNELAHLATHGPENPK LEMLEKILQRQFSSSNSPRGIIFTRTRQSAHSLLLWLQQQQGLQTVDIRA QLLIGAGNSSQSTHMTQRDQQEVIQKFQDGTLNLLVATSVAEEGLDIPHC NVVVRYGLLTNEISMVQARGRARADQSVYAFVATEGSRELKRELINEALE TLMEQAVAAVQKMDQAEYQAKIRDLQQAALTKRAAQAAQRENQRQQFPVE HVQLLCINCMVAVGHGSDLRKVEGTHHVNVNPNFSNYYNVSRDPVVINKV FKDWKPGGVISCRNCGEVWGLQMIYKSVKLPVLKVRSMLLETPQGRIQAK KWSRVPFSVPDFDFLQHCAENLSDLSLD
    • Amino acids
      1 to 678
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153504 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D11LGP2
    • D11lgp2e
    • DEXH (Asp Glu X His) box polypeptide 58
    • DEXH box polypeptide 58
    • DHX 58
    • DHX58
    • DHX58_HUMAN
    • LGP 2
    • LGP2
    • Ortholog of mouse D11lgp2
    • Probable ATP dependent helicase LGP2
    • Probable ATP dependent RNA helicase DHX58
    • Probable ATP-dependent helicase LGP2
    • Probable ATP-dependent RNA helicase DHX58
    • Protein D11Lgp2 homolog
    • RIG-I-like receptor LGP2
    • RLR
    • RNA helicase LGP2
    see all
  • Function
    Participates in innate immune defense against viruses. Upon interaction with intracellular dsRNA produced during viral replication, triggers a transduction cascade which results in the induction and expression of antiviral cytokines such as IFN-beta and RANTES (CCL5). The RNA helicase domain may recognize and structurally modify viral RNA to facilitate detection by DDX58/RIG-I or by IFIH1/MDA5 whose affinity for dsRNA is lower.
  • Sequence similarities
    Belongs to the helicase family.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab153504 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153504 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153504.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up