Overview

  • Product name
    Recombinant Human DHX8 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNR RRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
    • Molecular weight
      37 kDa including tags
    • Amino acids
      301 to 400

Specifications

Our Abpromise guarantee covers the use of ab114918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase DHX8
    • ATP-dependent RNA helicase dhx8
    • DDX 8
    • DDX8
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase)
    • DEAD/H box 8
    • DEAD/H box polypeptide 8
    • DEAH (Asp Glu Ala His) box polypeptide 8
    • DEAH box polypeptide 8
    • DEAH box protein 8
    • DHX 8
    • dhx8
    • DHX8_HUMAN
    • HRH 1
    • HRH1
    • PRP 22
    • PRP22
    • PRP22, S. cerevisiae, homolog of
    • PRPF 22
    • PRPF22
    • RNA helicase HRH 1
    • RNA helicase HRH1
    see all
  • Function
    Facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
  • Sequence similarities
    Belongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 S1 motif domain.
  • Domain
    The RS domain confers a nuclear localization signal, and appears to facilitate the interaction with the spliceosome.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human DHX8 protein images

  • 12.5% SDS-PAGE showing ab114918 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human DHX8 protein (ab114918)

ab114918 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up