Overview

  • Product nameRecombinant Human DHX8 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ14562
    • SpeciesHuman
    • SequenceRREGRVANVADVVSKGQRVKVKVLSFTGTKTSLSMKDVDQETGEDLNPNR RRNLVGETNEETSMRNPDRPTHLSLVSAPEVEDDSLERKRLTRISDPEKW
    • Molecular weight37 kDa including tags
    • Amino acids301 to 400

Specifications

Our Abpromise guarantee covers the use of ab114918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ATP dependent RNA helicase DHX8
    • ATP-dependent RNA helicase dhx8
    • DDX 8
    • DDX8
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8
    • DEAD/H (Asp Glu Ala Asp/His) box polypeptide 8 (RNA helicase)
    • DEAD/H box 8
    • DEAD/H box polypeptide 8
    • DEAH (Asp Glu Ala His) box polypeptide 8
    • DEAH box polypeptide 8
    • DEAH box protein 8
    • DHX 8
    • dhx8
    • DHX8_HUMAN
    • HRH 1
    • HRH1
    • PRP 22
    • PRP22
    • PRP22, S. cerevisiae, homolog of
    • PRPF 22
    • PRPF22
    • RNA helicase HRH 1
    • RNA helicase HRH1
    see all
  • FunctionFacilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.
  • Sequence similaritiesBelongs to the DEAD box helicase family. DEAH subfamily. DDX8/PRP22 sub-subfamily.
    Contains 1 helicase ATP-binding domain.
    Contains 1 helicase C-terminal domain.
    Contains 1 S1 motif domain.
  • DomainThe RS domain confers a nuclear localization signal, and appears to facilitate the interaction with the spliceosome.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DHX8 protein images

  • 12.5% SDS-PAGE showing ab114918 at approximately 36.63kDa.
    Stained with Coomassie Blue.

References for Recombinant Human DHX8 protein (ab114918)

ab114918 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"