Recombinant Human Dihydropyrimidinase protein (ab158312)

Overview

  • Product name
    Recombinant Human Dihydropyrimidinase protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AVNFNIFEGMVCHGVPLVTISRGKVVYEAGVFSVTAGDGKFIPRKPFAEY IYKRIKQRDRTCTPTPVERAPYKGEVATLKSRVTKEDATAGTRKQAHP
    • Amino acids
      422 to 519
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158312 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DHP
    • DHPase
    • Dihydropyrimidinase
    • Dihydropyrimidine amidohydrolase
    • Dpys
    • DPYS_HUMAN
    • Hydantoinase
    see all
  • Function
    Catalyzes the second step of the reductive pyrimidine degradation, the reversible hydrolytic ring opening of dihydropyrimidines. Can catalyzes the ring opening of 5,6-dihydrouracil to N-carbamyl-alanine and of 5,6-dihydrothymine to N-carbamyl-amino isobutyrate.
  • Tissue specificity
    Liver and kidney.
  • Involvement in disease
    Defects in DPYS are the cause of dihydropyrimidinase deficiency (DHPD) [MIM:222748]. DHPD is an autosomal recessive disorder characterized by dihydropyrimidinuria and associated with a variable clinical phenotype: epileptic or convulsive attacks, dysmorphic features and severe developmental delay, and congenital microvillous atrophy.
  • Sequence similarities
    Belongs to the DHOase family. Hydantoinase/dihydropyrimidinase subfamily.
  • Post-translational
    modifications
    Carbamylation allows a single lysine to coordinate two zinc ions.
  • Information by UniProt

Images

  • ab158312 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158312 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158312.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up