Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      PSDGWAIPGDSSLSFEVKKHQNQEDRCAAAQQLLERFSLPPQCRVVADRM DNNANIAYGVAFERVCIVQRQKIAYLGGKGPFSYNLQEVRHWLEKNFSKR
    • Molecular weight
      37 kDa including tags
    • Amino acids
      166 to 265

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152331 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5DII
    • D2
    • Deiodinase, iodothyronine, type II
    • DIO2
    • DIOII
    • EC 1.97.1.10
    • IOD2_HUMAN
    • ITDI2
    • SelY
    • Thyroxine deiodinase, type II
    • TXDI2
    • Type 2 DI
    • Type 2 iodothyronine deiodinase
    • Type II 5' deiodinase
    • Type II iodothyronine deiodinase
    • Type-II 5''-deiodinase
    see all
  • Function
    Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into T3 (3,5,3'-triiodothyronine). Essential for providing the brain with appropriate levels of T3 during the critical period of development.
  • Tissue specificity
    Heart, skeletal muscle, placenta, fetal brain and several regions of the adult brain.
  • Sequence similarities
    Belongs to the iodothyronine deiodinase family.
  • Post-translational
    modifications
    Ubiquitinated by MARCH6, leading to its degradation by the proteasome. Deubiquitinated by USP20 and USP33.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152331 stained with Coomassie Blue.

References

ab152331 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152331.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up