Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      KHFLGRRRRGQPEPEVELNSEGEEVPPDDPPICVSDDNRLCTLASLKAVW HGQKLDFFKQAHEGGPAPNSEVVLPDGFQSQHILDYAQGNRPLVLNFGSC T
    • Molecular weight
      37 kDa including tags
    • Amino acids
      43 to 143

Specifications

Our Abpromise guarantee covers the use of ab152333 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 5DIII
    • D3
    • Deiodinase iodothyronine type 3
    • Deiodinase iodothyronine type III
    • Dio 3
    • Dio3
    • DIOIII
    • IOD3_HUMAN
    • Iodothyronine deiodinase placental type
    • MGC124117
    • MGC124118
    • Thyroxine deiodinase type III
    • Thyroxine deiodinase type III (selenoprotein)
    • TXDI3
    • Type 3 DI
    • Type 3 iodothyronine selenodeiodinase
    • Type III 5' deiodinase
    • Type III iodothyronine deiodinase
    • Type-III 5''-deiodinase
    see all
  • Function
    Responsible for the deiodination of T4 (3,5,3',5'-tetraiodothyronine) into RT3 (3,3',5'-triiodothyronine) and of T3 (3,5,3'-triiodothyronine) into T2 (3,3'-diiodothyronine). RT3 and T2 are inactive metabolites. May play a role in preventing premature exposure of developing fetal tissues to adult levels of thyroid hormones. Can regulate circulating fetal thyroid hormone concentrations throughout gestation. Essential role for regulation of thyroid hormone inactivation during embryological development.
  • Tissue specificity
    Expressed in placenta and several fetal tissues.
  • Sequence similarities
    Belongs to the iodothyronine deiodinase family.
  • Cellular localization
    Cell membrane. Endosome membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152333 stained with Coomassie Blue.

References

ab152333 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152333.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up