Overview

  • Product name
    Recombinant Human DIRAS1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMPEQSNDYRVVVFGAGGVGKSSLVLRFVKG TFRDTYIPTIEDTYRQVISCDKSVCTLQITDTTGSHQFPAMQRLSISKGH AFILVFSVTSKQSLEELGPIYKLIVQIKGSVEDIPVMLVGNKCDETQREV DTREAQAVAQEWKCAFMETSAKMNYNVKELFQELLTLETRRNMSLNIDGK RSGKQKRTDRVKGKC
    • Molecular weight
      24 kDa including tags
    • Amino acids
      1 to 195
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab99389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 95 % SDS-PAGE.
    ab99389 is purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    Preservative: None
    Constituents: 20% Glycerol, 0.1M Sodium chloride, 20mM Tris HCl, 1mM EDTA, 1mM DTT, pH 8.0

General Info

  • Alternative names
    • Di Ras1
    • DIRAS family GTP binding RAS like 1
    • Distinct subgroup of the Ras family member 1
    • FLJ42681
    • GBTS1
    • GTP binding protein Di Ras1
    • Ras related inhibitor of cell growth
    • RIG
    • Rig protein
    • Small GTP binding tumor suppressor 1
    see all
  • Relevance
    The three human RAS genes encode highly related 188 to 189 amino acid proteins, designated H-Ras, N-Ras and K-Ras4A and K-Ras4B (the two K-Ras proteins arise from alternative gene splicing). Ras proteins function as binary molecular switches that control intracellular signaling networks. Ras-regulated signal pathways control such processes as actin cytoskeletal integrity, proliferation, differentiation, cell adhesion, apoptosis, and cell migration. Ras and ras-related proteins are often deregulated in cancers, leading to increased invasion and metastasis, and decreased apoptosis. DIRAS1 displays low GTPase activity and exists predominantly in the GTP-bound form. It is highly expressed in heart and brain.
  • Cellular localization
    Cell membrane; Lipid-anchor; Cytoplasmic side

Recombinant Human DIRAS1 protein images

  • 15% SDS-PAGE analysis of 3µg ab99389.

References for Recombinant Human DIRAS1 protein (ab99389)

ab99389 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab99389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up