Overview

  • Product name
    Recombinant Human DIRC2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MGSRWSSEEERQPLLGPGLGPGLGASWRSREAAAAALPAAVPGPGRVYGR RWLVLLLFSLLAFVQGLVWNTWGPIQNSARQAYGFSSWDIALLVLWGPIG FLPCFAFMWLLDKRGLRITVLLTSFLMVLGTGLRCIPISDLILKRRLIHG GQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIASMLSYLGGACAFLV GPLVVPAPNGTSPLLAAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYF PPRPPLPPSVAAASQRLSYRRSVCRLLSNFRFLMIALAYAIPLGVFAGWS GVLDLILTPAHVSQVDAGWIGFWSIVGGCVVGIAMARFADFIRGMLKLIL LLLFSGATLSSTWFTLTCLNSITHLPLTTVTLYASCILLGVFLNSSVPIF FELFVETVYPVPEGITCGVVTFLSNMFMGVLLFFLTFYHTELSWFNWCLP GSCLLSLLLILCFRESYDRLYLDVVVSV
    • Amino acids
      1 to 478
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164696 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DIRC 2
    • dirc2
    • DIRC2_HUMAN
    • Disrupted in renal cancer protein 2
    • Disrupted in renal carcinoma 2
    • Disrupted in renal carcinoma protein 2
    • FLJ14784
    • NP_116228
    • RCC 4
    • RCC4
    • Renal cell carcinoma 4
    see all
  • Function
    Electrogenic metabolite transporter.
  • Tissue specificity
    Ubiquitous. Expressed in proximal tubular cells of the kidney.
  • Involvement in disease
    Note=A chromosomal aberration involving DIRC2 has been found in a family with renal carcinoma. Translocation t(2;3)(q35;q21).
  • Sequence similarities
    Belongs to the major facilitator superfamily.
  • Post-translational
    modifications
    Cleaved in lysosomes by cathepsin L between Leu-214 and Ala-261, generating a N-glycosylated N-terminal and a non-glycosylated C-terminal fragment.
  • Cellular localization
    Lysosome membrane.
  • Information by UniProt

Images

  • ab164696 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164696 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164696.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up