Recombinant Human Dishevelled 2 protein (ab152348)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MAGSSTGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRP AGAKYFFKSMDQDFGVVKEEISDDNARLPCFNGRVVSWLVSSDNPQPEMA PPVHEPRAELAPPAPPLPPLPPERTSGIGDSRPPSFHPNVSSSHENLEPE TETESVVSLRRERPRRRDSSEHGAGGHRTGGPSRLERHLAGYESSSTLMT SELESTSLGDSDEEDTMSRFSSSTEQSSASRLLKRHRRRRKQRPPRLERT SSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLT VAKCWDPSPQAYFTLPRNEPIQPIDPAAWVSHSAALTGTFPAYPGSSSMS TITSGSSLPDGCEGRGLSVHTDMASVTKAMAAPESGLEVRDRMWLKITIP NAFLGSDVVDWLYHHVEGFPERREARKYASGLLKAGLIRHTVNKITFSEQ CYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLPGATPWPLLPT FSYQYPAPHPYSPQPPPYHELSSYTYGGGSASSQHSEGSRSSGSTRSDGG AGRTGRPEERAPESKSGSGSESEPSSRGGSLRRGGEASGTSDGGPPPSRG STGGAPNLRAHPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVPPAVQPPG APPVRDLGSVPPELTASRQSFHMAMGNPSEFFVDVM
    • Molecular weight
      105 kDa including tags
    • Amino acids
      1 to 736

Specifications

Our Abpromise guarantee covers the use of ab152348 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dishevelled 2 (homologous to Drosophila dsh)
    • Dishevelled dsh homolog 2
    • dishevelled segment polarity protein 2
    • Dishevelled-2
    • Dishevelled2
    • DSH homolog 2
    • DVL 2
    • Dvl2
    • DVL2_HUMAN
    • Segment polarity protein dishevelled homolog DVL 2
    • Segment polarity protein dishevelled homolog DVL-2
    • Segment polarity protein dishevelled homolog DVL2
    see all
  • Function
    Participates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Promotes internalization and degradation of frizzled proteins upon Wnt signaling. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes.
  • Sequence similarities
    Belongs to the DSH family.
    Contains 1 DEP domain.
    Contains 1 DIX domain.
    Contains 1 PDZ (DHR) domain.
  • Domain
    The DIX domain mediates homooligomerization.
  • Cellular localization
    Cell membrane. Cytoplasm > cytosol. Cytoplasmic vesicle. Localizes at the cell membrane upon interaction with frizzled family members and promotes their internalization. Localizes to cytoplasmic puncta.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152348 stained with Coomassie Blue.

References

ab152348 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152348.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up