Recombinant Human Dishevelled 3 protein (ab114497)

Overview

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ92997
    • SpeciesHuman
    • SequenceMGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMD DDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP PPMERTGGIGDSRPPSFHPHAGGGSQENLDNDTETDSLVSAQRERPRRRD GPEHATRLNGTAKGERRREPGGYDSSSTLMSSELETTSFFDSDEDDSTSR FSSSTEQSSASRLMRRHKRRRRKQKVSRIERSSSFSSITDSTMSLNIITV TLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEPGDMLL QVNEINFENMSNDDAVRVLREIVHKPGPITLTVAKCWDPSPRGCFTLPRS EPIRPIDPAAWVSHTAAMTGTFPAYGMSPSLSTITSTSSSITSSIPDTER LDDFHLSIHSDMAAIVKAMASPESGLEVRDRMLLKITIPNAFIGSDVVDW LYHNVEGFTDRREARKYASNLLKAGFIRHTVNKITFSEQCYYIFGDLCGN MANLSLHDHDGSSGASDQDTLAPLPHPGAAPWPMAFPYQYPPPPHPYNPH PGFPELGYSYGGGSASSQHSEGSRSSGSNRSGSDRRKEKDPKAGDSKSGG SGSESDHTTRSSLRGPRERAPSERSGPAASEHSHRSHHSLASSLRSHHTH PSYGPPGVPPLYGPPMLMMPPPPAAMGPPGAPPGRDLASVPPELTASRQS FRMAMGNPSEFFVDVM
    • Molecular weight105 kDa including tags
    • Amino acids1 to 716

Specifications

Our Abpromise guarantee covers the use of ab114497 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dishevelled 3
    • Dishevelled 3 (homologous to Drosophila dsh)
    • Dishevelled 3, dsh homolog (Drosophila)
    • Dishevelled, dsh homolog 3 (Drosophila)
    • Dishevelled-3
    • DSH homolog 3
    • dvl3
    • DVL3_HUMAN
    • KIAA0208
    • OTTHUMP00000210777
    • OTTHUMP00000210778
    • Segment polarity protein dishevelled homolog DVL 3
    • Segment polarity protein dishevelled homolog DVL-3
    see all
  • FunctionMay play a role in the signal transduction pathway mediated by multiple Wnt genes.
  • Sequence similaritiesBelongs to the DSH family.
    Contains 1 DEP domain.
    Contains 1 DIX domain.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications
    Ubiquitinated. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains.
  • Cellular localizationCytoplasm.
  • Information by UniProt

Recombinant Human Dishevelled 3 protein images

  • ab114497 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References for Recombinant Human Dishevelled 3 protein (ab114497)

ab114497 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114497.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"