Recombinant Human Dishevelled 3 protein (ab114498)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGETKIIYHLDGQETPYLVKLPLPAERVTLADFKGVLQRPSYKFFFKSMD DDFGVVKEEISDDNAKLPCFNGRVVSWLVSAEGSHPDPAPFCADNPSELP *
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 100

Specifications

Our Abpromise guarantee covers the use of ab114498 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dishevelled 3
    • Dishevelled 3 (homologous to Drosophila dsh)
    • Dishevelled 3, dsh homolog (Drosophila)
    • Dishevelled, dsh homolog 3 (Drosophila)
    • Dishevelled-3
    • DSH homolog 3
    • dvl3
    • DVL3_HUMAN
    • KIAA0208
    • OTTHUMP00000210777
    • OTTHUMP00000210778
    • Segment polarity protein dishevelled homolog DVL 3
    • Segment polarity protein dishevelled homolog DVL-3
    see all
  • Function
    May play a role in the signal transduction pathway mediated by multiple Wnt genes.
  • Sequence similarities
    Belongs to the DSH family.
    Contains 1 DEP domain.
    Contains 1 DIX domain.
    Contains 1 PDZ (DHR) domain.
  • Post-translational
    modifications
    Ubiquitinated. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab114498 analysed by 12.5% SDS-PAGE and stained with Coomassie Blue.

References

ab114498 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114498.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up