Recombinant Human Dishevelled / Dvl1 protein (ab116823)

Overview

  • Product nameRecombinant Human Dishevelled / Dvl1 protein
  • Protein lengthProtein fragment

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionO14640
    • SpeciesHuman
    • SequenceMAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFK SMDQDFGVVKEEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHT DLPPPLERTG
    • Molecular weight38 kDa including tags
    • Amino acids1 to 110

Specifications

Our Abpromise guarantee covers the use of ab116823 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dishevelled
    • Dishevelled 1
    • dishevelled 1 like
    • Dishevelled dsh homolog 1
    • Dishevelled-1
    • Dishevelled1
    • DSH homolog 1
    • Dvl
    • Dvl 1
    • Dvl1
    • DVL1_HUMAN
    • DVL1L1
    • MGC54245
    • Segment polarity protein dishevelled homolog DVL 1
    • segment polarity protein dishevelled homolog DVL 1 like
    • Segment polarity protein dishevelled homolog DVL-1
    • Segment polarity protein dishevelled homolog DVL1
    see all
  • FunctionParticipates in Wnt signaling by binding to the cytoplasmic C-terminus of frizzled family members and transducing the Wnt signal to down-stream effectors. Plays a role both in canonical and non-canonical Wnt signaling. Plays a role in the signal transduction pathways mediated by multiple Wnt genes. Required for LEF1 activation upon WNT1 and WNT3A signaling. DVL1 and PAK1 form a ternary complex with MUSK which is important for MUSK-dependent regulation of AChR clustering during the formation of the neuromuscular junction (NMJ).
  • Involvement in diseaseRobinow syndrome, autosomal dominant 2
  • Sequence similaritiesBelongs to the DSH family.
    Contains 1 DEP domain.
    Contains 1 DIX domain.
    Contains 1 PDZ (DHR) domain.
  • DomainThe DIX domain promotes homooligomerization.
    The DEP domain mediates interaction with the cell membrane.
  • Post-translational
    modifications
    Ubiquitinated; undergoes both 'Lys-48'-linked ubiquitination, leading to its subsequent degradation by the ubiquitin-proteasome pathway, and 'Lys-63'-linked ubiquitination. The interaction with INVS is required for ubiquitination. Deubiquitinated by CYLD, which acts on 'Lys-63'-linked ubiquitin chains.
  • Cellular localizationCell membrane. Cytoplasm, cytosol. Cytoplasmic vesicle. Localizes at the cell membrane upon interaction with frizzled family members.
  • Information by UniProt

Recombinant Human Dishevelled / Dvl1 protein images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab116823

References for Recombinant Human Dishevelled / Dvl1 protein (ab116823)

ab116823 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab116823.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"