Recombinant Human DKK1 protein (denatured) (ab156969)

Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSTLNSVLNSNAIKNLPPPLGGAAGHPGS AVSAAPGILYPGGNKYQTIDNYQPYPCAEDEECGTDEYCASPTRGGDAGV QICLACRKRRKRCMRHAMCCPGNYCKNGICVSSDQNHFRGEIEETITESF GNDHSTLDGYSRRTTLSSKMYHTKGQEGSVCLRSSDCASGLCCARHFWSK ICKPVLKEGQVCTKHRRKGSHGLEIFQRCYCGEGLSCRIQKDHHQASNSS RLHTCQRH
    • Molecular weight
      28 kDa including tags
    • Amino acids
      32 to 266
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab156969 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    >90% by SDS-PAGE.
    ab156969 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 2.4% Urea, 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • Dickkopf 1
    • Dickkopf 1 homolog
    • Dickkopf 1 like
    • Dickkopf homolog 1
    • Dickkopf like protein 1
    • Dickkopf related protein 1
    • Dickkopf WNT signaling pathway inhibitor 1
    • Dickkopf-1
    • Dickkopf-related protein 1
    • DKK 1
    • Dkk-1
    • Dkk1
    • DKK1_HUMAN
    • hDkk 1
    • hDkk-1
    • SK
    see all
  • Function
    Antagonizes canonical Wnt signaling by inhibiting LRP5/6 interaction with Wnt and by forming a ternary complex with the transmembrane protein KREMEN that promotes internalization of LRP5/6. DKKs play an important role in vertebrate development, where they locally inhibit Wnt regulated processes such as antero-posterior axial patterning, limb development, somitogenesis and eye formation. In the adult, Dkks are implicated in bone formation and bone disease, cancer and Alzheimer disease.
  • Tissue specificity
    Placenta.
  • Sequence similarities
    Belongs to the dickkopf family.
  • Domain
    The C-terminal cysteine-rich domain mediates interaction with LRP5 and LRP6.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab156969 (3 µg).

References

ab156969 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab156969.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up