Overview

  • Product name
    Recombinant Human DLG5 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      LDIAPHAIERLHHMHIYPIVIFIHYKSAKHIKEQRDPIYLRDKVTQRHSK EQFEAAQKLEQEYSRYFTGVIQGGALSSICTQILAMVNQEQNKVLWIPAC PL
    • Amino acids
      1708 to 1809
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160394 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Discs large homolog 5
    • Discs large homolog 5 (Drosophila)
    • Discs large protein LP DLG
    • Discs large protein P dlg
    • Discs large protein P-dlg
    • Disks large homolog 5
    • DLG 5
    • DLG5
    • DLG5_HUMAN
    • KIAA0583
    • Large type of P DLG
    • LP DLG
    • P DLG5
    • PDLG
    • Placenta and prostate DLG
    see all
  • Function
    May play a role at the plasma membrane in the maintenance of the structure of epithelial cells and in the transmission of extracellular signals to the membrane and cytoskeleton.
  • Tissue specificity
    Highly expressed in the placenta and prostate. Expressed at a lower level in the thyroid, spinal cord, trachea, adrenal gland, skeletal muscle, pancreas, heart, brain, liver and kidney. A short splice product shows more limited expression, being absent from at least the brain.
  • Sequence similarities
    Belongs to the MAGUK family.
    Contains 1 CARD domain.
    Contains 1 guanylate kinase-like domain.
    Contains 4 PDZ (DHR) domains.
    Contains 1 SH3 domain.
  • Cellular localization
    Cell junction. Cell membrane. Localized at sites of cell-cell contact.
  • Information by UniProt

Images

  • ab160394 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160394 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160394.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up