Recombinant Human DLGAP1 protein (ab160393)

Overview

  • Product name
    Recombinant Human DLGAP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MKGLSGSRSHHHGVTCDSACDSLSHHSDRKPYLLSPVEHHPADHPYYTQR NSFQAECVGPFSDPLASSTFPRRHYTSQQELKDECALVPRTLATKANRIP
    • Amino acids
      1 to 100
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160393 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 4933422O14Rik
    • 9630002F18
    • AI845682
    • AI848168
    • BB075781
    • D17Bwg0511e
    • DAP 1
    • DAP 1 ALPHA
    • DAP 1 BETA
    • DAP-1
    • DAP-1-ALPHA
    • DAP-1-BETA
    • DAP1
    • Discs large (Drosophila) homolog associated protein 1
    • Discs large homolog associated protein 1
    • Disks large associated protein 1
    • Disks large associated protein 1, alpha isoform, included
    • Disks large associated protein 1, beta isoform, included
    • Disks large-associated protein 1
    • DLGAP 1
    • Dlgap1
    • DLGP1_HUMAN
    • GKAP
    • GKAP/SAPAP
    • GKPA/SAPAP
    • Guanylate kinase associated protein
    • Guanylate kinase-associated protein
    • hGKAP
    • KIAA4162
    • MGC88156
    • mKIAA4162
    • PSD 95/SAP90 binding protein 1
    • PSD-95/SAP90-binding protein 1
    • SAP90/PSD 95 associated protein 1
    • SAP90/PSD-95-associated protein 1
    • SAPAP 1
    • SAPAP1
    see all
  • Function
    Part of the postsynaptic scaffold in neuronal cells.
  • Tissue specificity
    Expressed in brain.
  • Sequence similarities
    Belongs to the SAPAP family.
  • Cellular localization
    Cell membrane. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > synapse. Found in postsynaptic density of neuronal cells.
  • Information by UniProt

Images

  • ab160393 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160393 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160393.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up