Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVI NNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAE
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 99

Specifications

Our Abpromise guarantee covers the use of ab152339 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • 2-oxoglutarate dehydrogenase complex component E2
    • Dihydrolipoamide S succinyltransferase
    • Dihydrolipoamide S succinyltransferase (E2 component of 2 oxo glutarate complex)
    • Dihydrolipoamide succinyltransferase component of 2 oxoglutarate dehydrogenase complex
    • Dihydrolipoamide succinyltransferase component of 2-oxoglutarate dehydrogenase complex
    • Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex
    • Dihydrolipoyllysine residue succinyltransferase component of 2 oxoglutarate dehydrogenase complex mitochondrial
    • Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
    • Dlst
    • DLTS
    • E2
    • E2K
    • mitochondrial
    • ODO2_HUMAN
    • OGDC-E2
    see all
  • Function
    The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).
  • Pathway
    Amino-acid degradation; L-lysine degradation via saccharopine pathway; glutaryl-CoA from L-lysine: step 6/6.
  • Sequence similarities
    Belongs to the 2-oxoacid dehydrogenase family.
    Contains 1 lipoyl-binding domain.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152339 stained with Coomassie Blue.

References

ab152339 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152339.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up