Overview

  • Product name
    Recombinant Human Dlx1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MTMTTMPESLNSPVSGKAVFMEFGPPNQQMSPSPMSHGHYSMHCLHSAGH SQPDGAYSSASSFSRPLGYPYVNSVSSHASSPYISSVQSYPGSASLAQSR LEDPGADSEKSTVVEGGEVRFNGKGKKIRKPRTIYSSLQLQALNRRFQQT QYLALPERAELAASLGLTQTQVKIWFQNKRSKFKKLMKQGGAALEGSALA NGRALSAGSPPVPPGWNPNSSSGKGSGGNAGSYIPSYTSWYPSAHQEAMQ QPQLM
    • Molecular weight
      54 kDa including tags
    • Amino acids
      1 to 255

Associated products

Specifications

Our Abpromise guarantee covers the use of ab152340 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • DII B
    • Distal less homeo box 1
    • Distal less homeobox 1
    • Distal-less homeobox gene 1a
    • Dlx
    • Dlx 1
    • Dlx1
    • Dlx1 distal-less homeobox 1
    • DLX1_HUMAN
    • Homeo box protein DLX1
    • Homeobox protein DLX 1
    • Homeobox protein DLX-1
    • Homeobox protein Dlx1a
    • Homeodomain transcription factor DLX1
    • MGC189409
    • OTTHUMP00000082494
    • OTTHUMP00000082497
    • OTTMUSP00000014202
    • RP23-419H3.3
    see all
  • Function
    Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis and may be involved in the early development of diencephalic subdivisions.
  • Sequence similarities
    Belongs to the distal-less homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152340 stained with Coomassie Blue.

References

ab152340 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152340.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up