Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MSGSFDRKLSSILTDISSSLSCHAGSKDSPTLPESSVTDLGYYSAPQHDY YSGQPYGQTVNPYTYHHQFNLNGLAGTGAYSPKSEYTYGASYRQYGAYRE QPLPAQDPVSVKEEPEAEVRMVNGKPKKVRKPRTIYSSYQLAALQRRFQK AQYLALPERAELAAQLGLTQTQVKIWFQNRRSKFKKLYKNGEVPLEHSPN NSDSMACNSPPSPALWDTSSHSTPAPARSQLPPPLPYSASPSYLDDPTNS WYHAQNLSGPHLQQQPPQPATLHHASPGPPPNPGAVY
    • Molecular weight
      57 kDa including tags
    • Amino acids
      1 to 287

Specifications

Our Abpromise guarantee covers the use of ab114709 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml. Best use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AI4
    • Distal less homeo box 3
    • DLX 3
    • Dlx3
    • DLX3 distalless homeobox 3
    • DLX3_HUMAN
    • Homeobox protein DLX 3
    • Homeobox protein DLX-3
    • Homeobox protein Dlx3
    • TDO
    see all
  • Function
    Likely to play a regulatory role in the development of the ventral forebrain. May play a role in craniofacial patterning and morphogenesis.
  • Involvement in disease
    Defects in DLX3 are a cause of trichodentoosseous syndrome (TDO) [MIM:190320]. TDO is an autosomal dominant syndrome characterized by enamel hypoplasia and hypocalcification with associated strikingly curly hair.
    Defects in DLX3 are the cause of amelogenesis imperfecta type 4 (AI4) [MIM:104510]; also known as amelogenesis imperfecta hypomaturation-hypoplastic type with taurodontism. AI4 is an autosomal dominant defect of enamel formation associated with enlarged pulp chambers.
  • Sequence similarities
    Belongs to the distal-less homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human DLX3 protein images

  • 12.5% SDS-PAGE showing ab114709 at approximately 57.31kDa stained with Coomassie Blue.

References for Recombinant Human DLX3 protein (ab114709)

ab114709 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114709.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up