Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTSLPCPLPGRDASKAVFPDLAPVPSVAAAYPLGLSPTTAASPNLSYSRP YGHLLSYPYTEPANPGDSYLSCQQPAALSQPLCGPAEHPQELEADSEKPR LSPEPSERRPQAPAKKLRKPRTIYSSLQLQHLNQRFQHTQYLALPERAQL AAQLGLTQTQVKIWFQNKRSKYKKLLKQNSGGQEGDFPGRTFSVSPCSPP LPSLWDLPKAGTLPTSGYGNSFGAWYQHHSSDVLASPQMM
    • Amino acids
      1 to 240
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158287 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta protein 1
    • BP1
    • Distal less homeo box 7
    • Distal less homeo box 9
    • distal-less homeobox 4
    • DLX4
    • DLX4_HUMAN
    • DLX7
    • DLX8
    • DLX9
    • Homeobox protein DLX-4
    • Homeobox protein DLX-7
    • Homeobox protein DLX-8
    • Homeobox protein DLX4
    see all
  • Function
    May play a role in determining the production of hemoglobin S. May act as a repressor.
  • Tissue specificity
    Expressed in leukemia cells and placenta. Also expressed in kidney and fetal liver.
  • Sequence similarities
    Belongs to the distal-less homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158287 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158287 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158287.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up