Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      PYASGGGNSYNHRSLAAYPYMSHSQHSPYLQSYHNSSAAAQTRGDDTDQQ KTTVIENGEIRFNGKGKKIRKPRTIYSSLQLQALNHRFQQ
    • Amino acids
      71 to 160
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158290 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Distal less homeo box 6
    • Distal less homeobox 6
    • Distal less homeobox gene 6a
    • DLX6
    • DLX6_HUMAN
    • Homeobox protein DLX-6
    • MGC125282
    • MGC125283
    • MGC125284
    • MGC125285
    • OTTHUMP00000205294
    see all
  • Sequence similarities
    Belongs to the distal-less homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Developmental stage
    First expressed in embryos at 8.5-9 days in facial and branchial arch mesenchyme, otic vesicles and frontonasal ectoderm around olfactory placodes, a day later expression is seen in the developing forebrain in primordia of the ganglionic eminence and ventral diencephalic regions. In day 12.5 embryos, expressed in the brain and bones, and also in all skeletal structures of midgestation embryos after the first cartilage formation, and expression progressively declines in both brain and skeleton in day 15 embryos.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158290 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158290 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158290.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up