Overview

  • Product name
    Recombinant Human DMC1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      GELAERQQKLAQMLSRLQKISEEYNVAVFVTNQMTADPGATMTFQADPKK PIGGHILAHASTTRISLRKGRGELRIAKIYDSPEMPENEATFAITAGGIG DAK
    • Amino acids
      237 to 339
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161320 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Disrupted meiotic cDNA 1 homolog
    • Disrupted meiotic cDNA 1, yeast, homolog of
    • dJ199H16.1
    • DMC 1
    • DMC1
    • DMC1 dosage suppressor of mck1 homolog
    • DMC1 dosage suppressor of mck1 homolog meiosis specific homologous recombination (yeast)
    • DMC1 homologue
    • DMC1_HUMAN
    • DMC1H
    • DNA meiotic recombinase 1
    • HsLim15
    • LIM15
    • Meiotic recombination protein DMC1/LIM15 homolog
    • MGC150472
    • MGC150473
    see all
  • Function
    May participate in meiotic recombination, specifically in homologous strand assimilation, which is required for the resolution of meiotic double-strand breaks.
  • Sequence similarities
    Belongs to the RecA family. DMC1 subfamily.
    Contains 1 HhH domain.
  • Cellular localization
    Nucleus. Chromosome.
  • Information by UniProt

Images

  • ab161320 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161320 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161320.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up