Overview

  • Product name
    Recombinant Human DMGDH protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ANVIPKVGFTNISHMLTPKGRVYAELTVSHQSPGEFLLITGSGSELHDLR WIEEEAVKGGYDVEIKNITDELGVLGVAGPQARKVLQKLTSEDLSDDVFK FLQTKSLKVS
    • Amino acids
      556 to 665
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162291 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dimethylglycine dehydrogenase
    • Dimethylglycine dehydrogenase, mitochondrial
    • Dmgdh
    • M2GD_HUMAN
    • ME2GLYDH
    • mitochondrial
    see all
  • Pathway
    Amine and polyamine degradation; betaine degradation; sarcosine from betaine: step 2/2.
  • Involvement in disease
    Defects in DMGDH are the cause of DMGDH deficiency (DMGDHD) [MIM:605850]. DMGDHD is a disorder characterized by fish odor, muscle fatigue with increased serum creatine kinase. Biochemically it is characterized by an increase of N,N-dimethylglycine (DMG) in serum and urine.
  • Sequence similarities
    Belongs to the GcvT family.
  • Cellular localization
    Mitochondrion.
  • Information by UniProt

Images

  • ab162291 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162291 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162291.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up