Overview

  • Product name
    Recombinant Human DMRT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGS SRGGGSGSGASDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDC QCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRE NNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGG SPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYL GQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA VLECEPASEPSSFTVTPVIEEDE
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 373

Specifications

Our Abpromise guarantee covers the use of ab114958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CT154
    • DM domain expressed in testis 1
    • DM domain expressed in testis protein 1
    • DM domain gene expressed in testis
    • DMRT 1
    • dmrt1
    • DMRT1_HUMAN
    • DMT 1
    • DMT1
    • Doublesex and mab 3 related transcription factor 1
    • Doublesex- and mab-3-related transcription factor 1
    see all
  • Function
    May be required for testis development.
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Developmental stage
    Expressed in the genital ridges of six-week-old male embryos. Becomes confined to the forming seminiferous tubules (possibly Sertoli cells) at seven weeks. Not detected in female embryos.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab114958 at approximately 67.14kDa.
    Stained with Coomassie Blue.

References

ab114958 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab114958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up