Overview

  • Product name
    Recombinant Human DMRT1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGS SRGGGSGSGASDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDC QCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRE NNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGG SPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYL GQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA VLECEPASEPSSFTVTPVIEEDE
    • Molecular weight
      67 kDa including tags
    • Amino acids
      1 to 373

Specifications

Our Abpromise guarantee covers the use of ab114958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CT154
    • DM domain expressed in testis 1
    • DM domain expressed in testis protein 1
    • DM domain gene expressed in testis
    • DMRT 1
    • dmrt1
    • DMRT1_HUMAN
    • DMT 1
    • DMT1
    • Doublesex and mab 3 related transcription factor 1
    • Doublesex- and mab-3-related transcription factor 1
    see all
  • Function
    May be required for testis development.
  • Tissue specificity
    Testis specific.
  • Sequence similarities
    Belongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Developmental stage
    Expressed in the genital ridges of six-week-old male embryos. Becomes confined to the forming seminiferous tubules (possibly Sertoli cells) at seven weeks. Not detected in female embryos.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Recombinant Human DMRT1 protein images

  • 12.5% SDS-PAGE showing ab114958 at approximately 67.14kDa.
    Stained with Coomassie Blue.

References for Recombinant Human DMRT1 protein (ab114958)

ab114958 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up