Overview

  • Product nameRecombinant Human DMRT1 protein
  • Protein lengthFull length protein

Description

  • NatureRecombinant
  • SourceWheat germ
  • Amino Acid Sequence
    • AccessionQ9Y5R6
    • SpeciesHuman
    • SequenceMPNDEAFSKPSTPSEAPHAPGVPPQGRAGGFGKASGALVGAASGSSAGGS SRGGGSGSGASDLGAGSKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDC QCKKCNLIAERQRVMAAQVALRRQQAQEEELGISHPIPLPSAAELLVKRE NNGSNPCLMTECSGTSQPPPASVPTTAASEGRMVIQDIPAVTSRGHVENT PDLVSDSTYYSSFYQPSLFPYYNNLYNCPQYSMALAADSASGEVGNPLGG SPVKNSLRGLPGPYVPGQTGNQWQMKNMENRHAMSSQYRMHSYYPPPSYL GQSVPQFFTFEDAPSYPEARASVFSPPSSQDSGLVSLSSSSPISNKSTKA VLECEPASEPSSFTVTPVIEEDE
    • Molecular weight67 kDa including tags
    • Amino acids1 to 373

Associated products

Specifications

Our Abpromise guarantee covers the use of ab114958 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • FormLiquid
  • Additional notesProtein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • CT154
    • DM domain expressed in testis 1
    • DM domain expressed in testis protein 1
    • DM domain gene expressed in testis
    • DMRT 1
    • dmrt1
    • DMRT1_HUMAN
    • DMT 1
    • DMT1
    • Doublesex and mab 3 related transcription factor 1
    • Doublesex- and mab-3-related transcription factor 1
    see all
  • FunctionMay be required for testis development.
  • Tissue specificityTestis specific.
  • Sequence similaritiesBelongs to the DMRT family.
    Contains 1 DM DNA-binding domain.
  • Developmental stageExpressed in the genital ridges of six-week-old male embryos. Becomes confined to the forming seminiferous tubules (possibly Sertoli cells) at seven weeks. Not detected in female embryos.
  • Cellular localizationNucleus.
  • Information by UniProt

Recombinant Human DMRT1 protein images

  • 12.5% SDS-PAGE showing ab114958 at approximately 67.14kDa.
    Stained with Coomassie Blue.

References for Recombinant Human DMRT1 protein (ab114958)

ab114958 has not yet been referenced specifically in any publications.

Product Wall

There are currently no Abreviews or Questions for ab114958.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"